Edit |   |
Antigenic Specificity | TAR (HIV-1) RNA Binding Protein 2 (TARBP2) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, zebrafish |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARBP2 binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. |
Immunogen | TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT |
Other Names | trbp|trbp1|trbp2|MGC97783|TARBP2|LOQS|TRBP|TRBP1|TRBP2|fj51e12|wu:fj51e12|zgc:63778|Prbp |
Gene, Accession # | Gene ID: 336141,6895,21357,363006 |
Catalog # | ABIN629947 |
Price | |
Order / More Info | TAR (HIV-1) RNA Binding Protein 2 (TARBP2) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |