| 产品详情 |
| Edit |   |
| Antigenic Specificity | CCT6A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCT6A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCT6A. This antibody reacts with human, mouse, rat. The CCT6A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CCT6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK |
| Other Names | acute morphine dependence related protein 2, Acute morphine dependence-related protein 2, amino acid transport defect-complementing, CCT6, Cctz, CCT-zeta, CCT-zeta-1, chaperonin containing T-complex subunit 6, chaperonin containing TCP1, subunit 6A (zeta 1), histidine transport regulator 3, HTR3MGC126215, MGC126214, MoDP-2, T-complex protein 1 subunit zeta, T-complex protein 1, zeta subunit, TCP-1-zeta, TCP20, TCPZ, TTCP20 |
| Gene, Accession # | CCT6A, Gene ID: 908, Accession: P40227 |
| Catalog # | NBP2-46686 |
| Price | |
| Order / More Info | CCT6A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|