| Edit |   |
|---|
| Antigenic Specificity | LOC283130 (LOC283130) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC25A45 belongs to the SLC25 family of mitochondrial carrier proteins. |
|---|
| Immunogen | LOC283130 antibody was raised using the C terminal Of Loc283130 corresponding to a region with amino acids GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN630364 |
|---|
| Price | |
|---|
| Order / More Info | LOC283130 (LOC283130) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|