| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IDO1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-IDO1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | indoleamine 2,3-dioxygenase 1; Indoleamine 2,3-dioxygenase 1; indoleamine 2,3-dioxygenase 1; indoleamine 2,3-dioxygenase 1; Indoleamine-pyrrole 2,3-dioxygenase, IDO1; IDO1; IDO; INDO; IDO-1; IDO; INDO; IDO-1 |
|---|
| Gene, Accession # | IDO1, Gene ID: 3620, NCBI: NP_002155.1, UniProt: P14902 |
|---|
| Catalog # | MBS178128 |
|---|
| Price | |
|---|
| Order / More Info | IDO1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Burkin, D. J., Kimbro, K. S., Barr, B. L., Jones, C., Taylor, M. W., Gupta, S. L. Localization of the human indoleamine 2,3-dioxygenase (IDO) gene to the pericentromeric region of human chromosome 8. Genomics 17: 262-263, 1993. 2. Dai, W., Gupta, S. L. Molecular cloning, sequencing and expression of human interferon-gamma-inducible indoleamine 2,3-dioxygenase cDNA. Biochem. Biophys. Res. Commun. 168: 1-8, 1990. 3. Fallarino, F., Grohmann, U., Hwang, K. W., Orabona, C., Vacca, C., Bianchi, R., |
|---|
| 产品资料 |
|
|