产品详情 |
Edit |   |
Antigenic Specificity | ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ATP6V0A1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. ATP6V0A1 is one of three A subunit proteins and it is associated with clathrin-coated vesicles. |
Immunogen | ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE |
Other Names | A1|ATP6N1|ATP6N1A|Stv1|VPP1|Vph1|a1|AA959968|ATP6a1|Atp6n1|Atp6n1a|Atpv0a1|Vpp-1|Vpp1 |
Gene, Accession # | Gene ID: 535,11975,29757 |
Catalog # | ABIN635431 |
Price | |
Order / More Info | ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |
产品资料 |
|
|