| Edit |   |
| Antigenic Specificity | PFKFB4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 97%, rat 97%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human PFKFB4 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI |
| Other Names | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 |
| Gene, Accession # | Gene ID: 5210, UniProt: Q16877, ENSG00000114268 |
| Catalog # | HPA047719 |
| Price | |
| Order / More Info | PFKFB4 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |