Edit |   |
Antigenic Specificity | ZRANB2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZRANB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZRANB2. This antibody reacts with human. The ZRANB2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ZRANB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS |
Other Names | Oocyte-specific maternal effect factor, zygote arrest 1, zygote arrest protein 1 |
Gene, Accession # | ZRANB2, Gene ID: 9406 |
Catalog # | NBP2-56264 |
Price | |
Order / More Info | ZRANB2 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |