Edit |   |
Antigenic Specificity | ZPLD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZPLD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZPLD1. This antibody reacts with human. The ZPLD1 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to ZPLD1(zona pellucida-like domain containing 1) The peptide sequence was selected form the C terminal of ZPLD1. Peptide sequence DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA. |
Other Names | zinc finger and homeodomain protein 1, zinc fingers and homeobox 1, zinc fingers and homeoboxes 1, zinc fingers and homeoboxes protein 1, zinc-fingers and homeoboxes 1 |
Gene, Accession # | ZPLD1, Gene ID: 131368, Accession: Q8TCW7, SwissProt: Q8TCW7 |
Catalog # | NBP1-62724 |
Price | |
Order / More Info | ZPLD1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |