Edit |   |
Antigenic Specificity | ZNF826P |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZNF826P Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF826P. This antibody reacts with human. The ZNF826P Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the middle region of human FLJ44894. Peptide sequence HRRTHTGEKPYKCEECGKAFTASSTLSEYKTIHTGEKPCKCEECGKAFNW. |
Other Names | ZNF826, ZNF826P zinc finger protein 826, pseudogene |
Gene, Accession # | FLJ44894, Gene ID: 664701 |
Catalog # | NBP1-91370 |
Price | |
Order / More Info | ZNF826P Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |