Edit |   |
Antigenic Specificity | ZNF724P |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZNF724P Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF724P. This antibody reacts with human. The ZNF724P Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the N terminal of human ZNF724P. Peptide sequence KGSYNGFNQCLTTTQSKIFQCDKYVKDFHKFSNSNRHKTEKNPFKCKECG. |
Other Names | ZNF724P zinc finger protein 724, pseudogene |
Gene, Accession # | ZNF724P, Gene ID: 440519 |
Catalog # | NBP1-91390-20ul |
Price | |
Order / More Info | ZNF724P Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |