| 产品详情 |
| Edit |   |
| Antigenic Specificity | Lck |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband™ antibody for Tyrosine-protein kinase Lck(LCK) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Lck (or lymphocyte-specific protein tyrosine kinase) is a 56 kDa protein that is found inside specializedcells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids. |
| Other Names | Tyrosine-protein kinase Lck;2.7.10.2;Leukocyte C-terminal Src kinase;LSK;Lymphocyte cell-specific protein-tyrosine kinase;Protein YT16;Proto-oncogene Lck;T cell-specific protein-tyrosine kinase;p56-LCK;LCK; |
| Gene, Accession # | LCK, UniProt: P06239 |
| Catalog # | PB9808 |
| Price | |
| Order / More Info | Lck Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 产品资料 |
|
|