Edit |   |
Antigenic Specificity | PQLC2L |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The PQLC2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to PQLC2L. This antibody reacts with human. The PQLC2L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C3orf55 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCW IGGDLTNFKGCYLTNQLP |
Other Names | C3orf55 chromosome 3 open reading frame 55 |
Gene, Accession # | C3orf55, Gene ID: 152078 |
Catalog # | NBP2-14781 |
Price | |
Order / More Info | PQLC2L Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |