产品详情 |
Edit |   |
Antigenic Specificity | p53R2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The p53R2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to p53R2. This antibody reacts with human. The p53R2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human p53R2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV |
Other Names | EC 1.17.4.1, MGC102856, MGC42116, MTDPS8A, MTDPS8B, p53-inducible ribonucleotide reductase small subunit 2 homolog, p53-inducible ribonucleotide reductase small subunit 2-like protein, p53R2, P53R2DKFZp686M05248, PEOA5, ribonucleoside-diphosphate reductase subunit M2 B, ribonucleotide reductase M2 B (TP53 inducible), TP53-inducible ribonucleotide reductase M2 B |
Gene, Accession # | RRM2B, Gene ID: 50484, Accession: Q7LG56, SwissProt: Q7LG56 |
Catalog # | NBP1-87368 |
Price | |
Order / More Info | p53R2 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|