产品详情 |
Edit |   |
Antigenic Specificity | CYP11B2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The CYP11B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYP11B2. This antibody reacts with human. The CYP11B2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CYP11B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL |
Other Names | ALDOSCYP11B, Aldosterone synthase, Aldosterone-synthesizing enzyme, CPN2, CYP11BL, CYPXIB2, cytochrome P450 11B2, mitochondrial, cytochrome P450, family 11, subfamily B, polypeptide 2, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2, Cytochrome P-450Aldo, Cytochrome P-450C18, EC 1.14.15, EC 1.14.15.4, EC 1.14.15.5, mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2, P450aldo, P450C18, P-450C18, steroid 11-beta/18-hydroxylase, steroid 11-beta-monooxygenase, Steroid 18-hydroxylase, steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo |
Gene, Accession # | CYP11B2, Gene ID: 1585 |
Catalog # | NBP2-13891 |
Price | |
Order / More Info | CYP11B2 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | PubMed: 29212953 |
产品资料 |
|
|