产品详情 |
Edit |   |
Antigenic Specificity | STEAP3/TSAP6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The STEAP3/TSAP6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STEAP3/TSAP6. This antibody reacts with human. The STEAP3/TSAP6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human STEAP3/TSAP6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKI LVDVSNPTEQEHLQHRE |
Other Names | dudlin 2, dudlin-2, dudulin 2, dudulin-2, Dudulin-2,1010001D01Rik, EC 1.16.1.-, hpHyde, hTSAP6, metalloreductase STEAP3, pHyde, six transmembrane prostate protein 3, Six-transmembrane epithelial antigen of prostate 3, STEAP family member 3, TSAP6STMP3, tumor suppressor pHyde, Tumor suppressor-activated pathway protein 6 |
Gene, Accession # | STEAP3, Gene ID: 55240 |
Catalog # | NBP2-13395 |
Price | |
Order / More Info | STEAP3/TSAP6 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|