| 产品详情 |
| Edit |   |
| Antigenic Specificity | BAT3/BAG6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BAT3/BAG6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BAT3/BAG6. This antibody reacts with human. The BAT3/BAG6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BAT3/BAG6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS |
| Other Names | BAT3HLA-B associated transcript-3, BCL2-associated athanogene 6BAG-6, D6S52EHLA-B-associated transcript 3, G3BAG family molecular chaperone regulator 6, HLA-B associated transcript 3, large proline-rich protein BAT3, Protein G3, Protein Scythe, scythe |
| Gene, Accession # | BAG6, Gene ID: 7917, Accession: P46379, SwissProt: P46379 |
| Catalog # | NBP2-38693 |
| Price | |
| Order / More Info | BAT3/BAG6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|