| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZRANB1/Trabid |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZRANB1/Trabid Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZRANB1/Trabid. This antibody reacts with human. The ZRANB1/Trabid Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZRANB1/Trabid antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPELTEQIRREIAASLHQRKGDFACYFLTDLVTFTLPADIEDLP |
|---|
| Other Names | HRPE773, jacalin-like lectin domain containing 2, JCLN2, pancreatic adenocarcinoma upregulated factor, PAUF, PRO1567, zymogen granule protein 16 homolog B, zymogen granule protein 16 homolog B (rat) |
|---|
| Gene, Accession # | ZRANB1, Gene ID: 54764 |
|---|
| Catalog # | NBP1-86917 |
|---|
| Price | |
|---|
| Order / More Info | ZRANB1/Trabid Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|