| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. |
|---|
| Immunogen | SULT1 C2 antibody was raised using the C terminal of SULT1 2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL |
|---|
| Other Names | MGC53039|st1c1|st1c2|sult1c1|MGC88979|SULT1C1|SULT1C2|(PST)G|P-SULT|ST1C1|Stp2|Sult1a2|mOLFST|ST1C2|humSULTC2|1810008N17Rik|Sult1c1|HAST-I|St1c1 |
|---|
| Gene, Accession # | Gene ID: 6819,69083,171072 |
|---|
| Catalog # | ABIN630789 |
|---|
| Price | |
|---|
| Order / More Info | Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|