| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PC4/SUB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (predicted: hamster) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | Flow Cytometry, IHC-P, IHC-F, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Activated RNA polymerase II transcriptional coactivator p15(SUB1) detection. Tested with WB, IHC-P, IHC-F, FCM in Human;Mouse;Rat. No cross reactivity with other proteins. Activated RNA polymerase II transcriptional coactivator p15, also known as positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid. |
|---|
| Other Names | Activated RNA polymerase II transcriptional coactivator p15;Positive cofactor 4;PC4;SUB1 homolog;p14;SUB1;PC4, RPO2TC1; |
|---|
| Gene, Accession # | SUB1, UniProt: P53999 |
|---|
| Catalog # | PB10098 |
|---|
| Price | |
|---|
| Order / More Info | PC4/SUB1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|