产品详情 |
Edit |   |
Antigenic Specificity | Cadherin-17 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The Cadherin-17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cadherin-17. This antibody reacts with human. The Cadherin-17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cadherin-17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK |
Other Names | cadherin, cadherin 17, LI cadherin (liver-intestine), cadherin-16, cadherin-17, CDH16, FLJ26931, HPT1, HPT-1, HPT-1 cadherin, human intestinal peptide-associated transporter HPT-1, human peptide transporter 1, Intestinal peptide-associated transporter HPT-1, LI cadherin, LI-cadherin, Liver-intestine cadherin, MGC138218, MGC142024 |
Gene, Accession # | CDH17, Gene ID: 1015 |
Catalog # | NBP1-88238 |
Price | |
Order / More Info | Cadherin-17 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | PubMed: 21677534 |
产品资料 |
|
|