产品详情 |
Edit |   |
Antigenic Specificity | Isocitrate Dehydrogenase 1/IDH1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 25ul |
Concentration | n/a |
Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The Isocitrate Dehydrogenase 1/IDH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Isocitrate Dehydrogenase 1/IDH1. This antibody reacts with human. The Isocitrate Dehydrogenase 1/IDH1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA |
Other Names | Cytosolic NADP-isocitrate dehydrogenase, EC 1.1.1.42, IDCD, IDH, IDP, IDPC, isocitrate dehydrogenase [NADP] cytoplasmic, isocitrate dehydrogenase 1 (NADP+), soluble, NADP(+)-specific ICDH, NADP-dependent isocitrate dehydrogenase, cytosolic, NADP-dependent isocitrate dehydrogenase, peroxisomal, Oxalosuccinate decarboxylase, PICD |
Gene, Accession # | IDH1, Gene ID: 3417, Accession: O75874, SwissProt: O75874 |
Catalog # | NBP2-34091-25ul |
Price | |
Order / More Info | Isocitrate Dehydrogenase 1/IDH1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|