Edit |   |
Antigenic Specificity | AKAIN1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The AKAIN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKAIN1. This antibody reacts with human. The AKAIN1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C18orf42 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FWLGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNR DHIQLGVGELTKKHEKK |
Other Names | C18orf42, C18orf42 chromosome 18 open reading frame 42 |
Gene, Accession # | C18orf42, Gene ID: 642597 |
Catalog # | NBP2-14679 |
Price | |
Order / More Info | AKAIN1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |