产品详情 |
Edit |   |
Antigenic Specificity | ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A. This antibody reacts with human. The ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to ST3GAL1(ST3 beta-galactoside alpha-2,3-sialyltransferase 1) The peptide sequence was selected from the C terminal of ST3GAL1. Peptide sequence YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN. |
Other Names | Alpha 2,3-ST 1, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1, DKFZp666E036, DKFZp779K2051, EC 2.4.99, EC 2.4.99.4, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, Sialyltransferase 4A, sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialyltransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase), SIAT4, SIAT4A, SIAT4-A, SIATFLFLJ36548, ST3 beta-galactoside alpha-2,3-sialyltransferase 1, ST3Gal I, ST3GalA.1MGC9183, ST3GalI, ST3GalIA, ST3GalIA1,Beta-galactoside alpha-2,3-sialyltransferase 1, ST3OST3GalA |
Gene, Accession # | ST3GAL1, Gene ID: 6482, Accession: Q11201, SwissProt: Q11201 |
Catalog # | NBP1-62540 |
Price | |
Order / More Info | ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|