产品详情 |
Edit |   |
Antigenic Specificity | ST3GAL3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ST3GAL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST3GAL3. This antibody reacts with human. The ST3GAL3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ST3GAL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKY ANFSEGACKPGYASALMTAIF |
Other Names | alpha 2,3-sialyltransferase III, Alpha 2,3-ST 3, alpha-2,3-sialyltransferase II, Beta-galactoside alpha-2,3-sialyltransferase 3, CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase, EC 2.4.99.6, Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase, Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase, N-acetyllactosaminide alpha-2,3-sialyltransferase, Sialyltransferase 6, SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase), ST3 beta-galactoside alpha-2,3-sialyltransferase 3, ST3Gal III, ST3GALII, ST3GalIII, ST3N |
Gene, Accession # | ST3GAL3, Gene ID: 6487 |
Catalog # | NBP2-13389 |
Price | |
Order / More Info | ST3GAL3 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | PubMed: 25135641 |
产品资料 |
|
|