产品详情 |
Edit |   |
Antigenic Specificity | IL-1 RAPL2/IL-1 R9 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The IL-1 RAPL2/IL-1 R9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-1 RAPL2/IL-1 R9. This antibody reacts with human. The IL-1 RAPL2/IL-1 R9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL-1 RAPL2/IL-1 R9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SMSLTVAENESGLCYNSRIRYLEKSEVTKRKEISCPDMDDFKKSDQEPDVVWYKECKPKMWRSIIIQKGNALLIQEVQEEDGGNYTCELKYEG |
Other Names | IL-1R-9, IL1R9IL-1 receptor accessory protein-like 2, IL-1R9IL-1RAPL-2, IL-1-RAPL-2, IL1RAPL-2IL1RAPL-2-related protein, interleukin 1 receptor 9, interleukin 1 receptor accessory protein-like 2, Three immunoglobulin domain-containing IL-1 receptor-related 1, TIGIRR-1Interleukin-1 receptor 9, X-linked interleukin-1 receptor accessory protein-like 2 |
Gene, Accession # | IL1RAPL2, Gene ID: 26280, Accession: Q9NP60, SwissProt: Q9NP60 |
Catalog # | NBP2-38282 |
Price | |
Order / More Info | IL-1 RAPL2/IL-1 R9 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|