| Edit |   |
| Antigenic Specificity | CDV3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 92%, rat 87%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein., Genetic validation in WB by siRNA knockdown. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human CDV3 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LQSTAKHVESRKDKEMEKSFEVVRHKNRGRDEVSKNQALKLQLDNQYAVLENQKSSHSQYN |
| Other Names | CDV3 homolog (mouse), H41 |
| Gene, Accession # | Gene ID: 55573, UniProt: Q9UKY7, ENSG00000091527 |
| Catalog # | HPA029762 |
| Price | |
| Order / More Info | CDV3 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |