| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SULT2A1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-SULT2A1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | bile salt sulfotransferase; Bile salt sulfotransferase; bile salt sulfotransferase; sulfotransferase family 2A member 1; Dehydroepiandrosterone sulfotransferase; DHEA-ST; Hydroxysteroid Sulfotransferase; HST; ST2; ST2A3; Sulfotransferase 2A1; ST2A1, SULT2A1; SULT2A1; HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST; HST; STD; DHEA-ST; HST; ST2A1 |
|---|
| Gene, Accession # | SULT2A1, Gene ID: 6822, NCBI: NP_003158.2, UniProt: Q06520 |
|---|
| Catalog # | MBS177742 |
|---|
| Price | |
|---|
| Order / More Info | SULT2A1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: SULT2A1 sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1. 2. Otterness DM, Wieben ED, Wood TC, Watson WG, Madden BJ, McCormick DJ, Weinshilboum RM (May 1992). Human liver dehydroepiandrosterone sulfotransferase: molecular cloning and expression of cDNA. Mol. Pharmacol. 41(5): 865-72. 3. Otterness DM, Mohrenweiser HW, Brandriff BF, Weinshilboum RM (1995). Dehydroepiandrosterone sulfotransferase gene (STD): localization to human chromo |
|---|
| 产品资料 |
|
|