| Edit |   |
|---|
| Antigenic Specificity | Annexin A13 (ANXA13) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | n/a |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ANXA13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. |
|---|
| Immunogen | Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE |
|---|
| Other Names | anx13|wu:fb40a08|ANXA13|MGC108373|zgc:112421|ANX13|ISA|1810034H17Rik|AV055219 |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN630248 |
|---|
| Price | |
|---|
| Order / More Info | Annexin A13 (ANXA13) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|