| Edit |   |
|---|
| Antigenic Specificity | 24-Dehydrocholesterol Reductase (DHCR24) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. |
|---|
| Immunogen | DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE |
|---|
| Other Names | MGC82737|zgc:101638|DCE|Nbla03646|SELADIN1|seladin-1|2310076D10Rik|5830417J06Rik|mKIAA0018 |
|---|
| Gene, Accession # | Gene ID: 1718,74754,298298 |
|---|
| Catalog # | ABIN635527 |
|---|
| Price | |
|---|
| Order / More Info | 24-Dehydrocholesterol Reductase (DHCR24) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|