Edit |   |
Antigenic Specificity | RNA Binding Motif Protein 9 (RBM9) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. |
Immunogen | RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT |
Other Names | rta|fox2|xrbm9|hrnbp2|MGC79813|RBM9|rbm9a|FOX2|Fox-2|HNRBP2|HRNBP2|RTA|dJ106I20.3|fxh|2810460A15Rik|AA407676|AI118529|Fbm2|Fxh|Hrnbp2|Rbm9|rbm9|zgc:85694|fox-2|hnrbp2|rbfox2|rbm9-b|rbm9b |
Gene, Accession # | Gene ID: 23543 |
Catalog # | ABIN634463 |
Price | |
Order / More Info | RNA Binding Motif Protein 9 (RBM9) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |