Edit |   |
Antigenic Specificity | RNA Binding Motif Protein 39 (RBM39) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. |
Immunogen | RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE |
Other Names | RBM39|Rbm39|ACYPI002389|DKFZp459F148|CAPER|CAPERalpha|FSAP59|HCC1|RNPC2|rnpc2|1500012C14Rik|2310040E03Rik|B330012G18Rik|C79248|R75070|Rnpc2|caper|zgc:55780 |
Gene, Accession # | Gene ID: 9584,170791,362251 |
Catalog # | ABIN633242 |
Price | |
Order / More Info | RNA Binding Motif Protein 39 (RBM39) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |