Edit |   |
Antigenic Specificity | RNA Binding Motif Protein 38 (RBM38) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RBM38 is a probable RNA-binding protein. |
Immunogen | RBM38 antibody was raised using the middle region of RBM38 corresponding to a region with amino acids QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM |
Other Names | rnpc1|seb4b|seb4d|XSeb4R|MGC89204|hsrnaseb|YF-55|fi25e12|wu:fi25e12|zgc:92336|xseb4r|HSRNASEB|RNPC1|SEB4B|SEB4D|dJ800J21.2|Rnpc1|Seb4|Seb4l |
Gene, Accession # | Gene ID: 55544,56190,366262 |
Catalog # | ABIN633488 |
Price | |
Order / More Info | RNA Binding Motif Protein 38 (RBM38) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |