| Edit |   |
|---|
| Antigenic Specificity | RNA Binding Motif Protein 22 (RBM22) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RBM22 may be involved in pre-mRNA splicing. |
|---|
| Immunogen | RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV |
|---|
| Other Names | fb37a01|zgc:77910|wu:fb37a01|wu:fc62e03|wu:fe05c04|RBM22|Cwc2|ZC3H16|fSAP47|8430430L24Rik|cg14641 |
|---|
| Gene, Accession # | Gene ID: 55696,66810,307410 |
|---|
| Catalog # | ABIN633354 |
|---|
| Price | |
|---|
| Order / More Info | RNA Binding Motif Protein 22 (RBM22) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|