Edit |   |
Antigenic Specificity | RNA Binding Motif Protein 11 (RBM11) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of the protein has not been widely studied, and is yet to be fully elucidated. |
Immunogen | RBM11 antibody was raised using the middle region of RBM11 corresponding to a region with amino acids SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR |
Other Names | A330018F01 |
Gene, Accession # | Gene ID: 54033 |
Catalog # | ABIN633164 |
Price | |
Order / More Info | RNA Binding Motif Protein 11 (RBM11) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |