产品详情 |
Edit |   |
Antigenic Specificity | GFER/ALR |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The GFER/ALR Antibody from Novus Biologicals is a rabbit polyclonal antibody to GFER/ALR. This antibody reacts with human, rat. The GFER/ALR Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat GFER/ALR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD |
Other Names | ALRFAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, EC 1.8.3.2, ERV1 homolog, ERV1hepatopoietin protein, erv1-like growth factor, growth factor, augmenter of liver regeneration, growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration), Hepatopoietin, hERV1, HERV1hepatic regenerative stimulation substance, HPO, HPO1, HPO2, HSS, truncated augmenter of liver regeneration |
Gene, Accession # | GFER, Gene ID: 2671, Accession: P55789, SwissProt: P55789 |
Catalog # | NBP1-90187 |
Price | |
Order / More Info | GFER/ALR Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | PubMed: 25012650 |
产品资料 |
|
|