| Edit |   |
| Antigenic Specificity | Transmembrane Protease, serine 11D (TMPRSS11D) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. |
| Immunogen | TMPRSS11 D antibody was raised using the N terminal of TMPRSS11 corresponding to a region with amino acids RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA |
| Other Names | 2810009A20Rik|4833427O07Rik|5830447M11Rik|AA408215|Hy5|Ncoat|mKIAA0679|O-GLCNACASE|HAT|AST|AsP|BC020151|Asp |
| Gene, Accession # | Gene ID: 9407 |
| Catalog # | ABIN630466 |
| Price | |
| Order / More Info | Transmembrane Protease, serine 11D (TMPRSS11D) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |