Edit |   |
Antigenic Specificity | SRGAP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The SRGAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRGAP1. This antibody reacts with mouse. The SRGAP1 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the middle region of human Srgap1The immunogen for this antibody is Srgap1. Peptide sequence DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG. |
Other Names | ARHGAP13srGAP1, FLJ22166, KIAA1304SLIT-ROBO Rho GTPase-activating protein 1, Rho GTPase-activating protein 13, SLIT-ROBO Rho GTPase activating protein 1 |
Gene, Accession # | SRGAP1, Gene ID: 57522, Accession: AAL27030 |
Catalog # | NBP1-79674 |
Price | |
Order / More Info | SRGAP1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |