| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RanBP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RanBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RanBP2. This antibody reacts with human. The RanBP2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RanBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFK |
|---|
| Other Names | ANE1, E3 SUMO-protein ligase RanBP2, EC 5.2.1.8, Nuclear pore complex protein Nup358, nucleoporin 358, Nucleoporin Nup358, NUP358TRP2, P270, RAN binding protein 2, Ran-binding protein 2, RanBP2, transformation-related protein 2,358 kDa nucleoporin, TRP1 |
|---|
| Gene, Accession # | RANBP2, Gene ID: 5903 |
|---|
| Catalog # | NBP2-56520 |
|---|
| Price | |
|---|
| Order / More Info | RanBP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|