产品详情 |
Edit |   |
Antigenic Specificity | RanBP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The RanBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RanBP2. This antibody reacts with human. The RanBP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RanBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SNSESLLGLLTSDKPLQGDGYSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKSVFGTPTL |
Other Names | ANE1, E3 SUMO-protein ligase RanBP2, EC 5.2.1.8, Nuclear pore complex protein Nup358, nucleoporin 358, Nucleoporin Nup358, NUP358TRP2, P270, RAN binding protein 2, Ran-binding protein 2, RanBP2, transformation-related protein 2,358 kDa nucleoporin, TRP1 |
Gene, Accession # | RANBP2, Gene ID: 5903, Accession: P49792, SwissProt: P49792 |
Catalog # | NBP2-33881 |
Price | |
Order / More Info | RanBP2 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|