| Edit |   |
|---|
| Antigenic Specificity | Calcitonin Receptor-Like (CALCRL) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
|---|
| Immunogen | CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
|---|
| Other Names | CALCRL|CGRPR|CRLR|AV071593|CLR|Crlr|RATCRLR|RNCLR |
|---|
| Gene, Accession # | Gene ID: 10203,54598,25029 |
|---|
| Catalog # | ABIN634576 |
|---|
| Price | |
|---|
| Order / More Info | Calcitonin Receptor-Like (CALCRL) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|