Edit |   |
Antigenic Specificity | ARID5A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ARID5A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARID5A. This antibody reacts with human. The ARID5A Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the N terminal of human ARID5AThe immunogen for this antibody is ARID5A (NP_997646). Peptide sequence MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGERE. |
Other Names | ARID domain-containing protein 5A, AT rich interactive domain 5A (MRF1-like), AT-rich interactive domain-containing protein 5A, RFVG5814 |
Gene, Accession # | ARID5A, Gene ID: 10865, Accession: Q03989, SwissProt: Q03989 |
Catalog # | NBP1-79452 |
Price | |
Order / More Info | ARID5A Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |