| Edit |   |
|---|
| Antigenic Specificity | RHOBTB2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human RHOBTB2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL |
|---|
| Other Names | Rho-related BTB domain containing 2, DBC2, KIAA0717 |
|---|
| Gene, Accession # | Gene ID: 23221, UniProt: Q9BYZ6, ENSG00000008853 |
|---|
| Catalog # | HPA060938 |
|---|
| Price | |
|---|
| Order / More Info | RHOBTB2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|