| Edit |   |
|---|
| Antigenic Specificity | Fat Mass and Obesity-Associated (FTO) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The exact function of this gene is not known. Studies in mice suggest that it may be involved in nucleic acid demethylation, and that its mRNA level is regulated by feeding and fasting. Genomewide association studies of type 2 diabetes indicate this gene as a diabetes susceptibility locus. Mutation in this gene has been associated with growth retardation, developmental delay, coarse facies, and early death. |
|---|
| Immunogen | FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA |
|---|
| Other Names | AW743446|mKIAA1752|RGD1305121 |
|---|
| Gene, Accession # | Gene ID: 79068 |
|---|
| Catalog # | ABIN633096 |
|---|
| Price | |
|---|
| Order / More Info | Fat Mass and Obesity-Associated (FTO) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|