| Edit |   |
|---|
| Antigenic Specificity | Melanoma Antigen Family A, 10 (MAGEA10) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. |
|---|
| Immunogen | MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP |
|---|
| Other Names | MAGEA10|CT1.10|MAGE10|RGD1563693|MAGEA11 |
|---|
| Gene, Accession # | Gene ID: 4109 |
|---|
| Catalog # | ABIN632494 |
|---|
| Price | |
|---|
| Order / More Info | Melanoma Antigen Family A, 10 (MAGEA10) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|