| Edit |   |
|---|
| Antigenic Specificity | MAGEB18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 38%, rat 41%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human MAGEB18 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: STTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPIT |
|---|
| Other Names | melanoma antigen family B, 18, MGC33889 |
|---|
| Gene, Accession # | Gene ID: 286514, UniProt: Q96M61, ENSG00000176774 |
|---|
| Catalog # | HPA046141 |
|---|
| Price | |
|---|
| Order / More Info | MAGEB18 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|