| Edit |   |
|---|
| Antigenic Specificity | Glia Maturation Factor, gamma (GMFG) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of GMF gamma protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY |
|---|
| Other Names | MGC108238|zgc:136987|GMF-GAMMA|0610039G16Rik|2310057N07Rik|AI324845|gmf-gamma|ENSMUSG00000049365 |
|---|
| Gene, Accession # | Gene ID: 9535 |
|---|
| Catalog # | ABIN634779 |
|---|
| Price | |
|---|
| Order / More Info | Glia Maturation Factor, gamma (GMFG) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|