产品详情 |
Edit |   |
Antigenic Specificity | Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes. |
Immunogen | EIF4 G2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL |
Other Names | NAT1B|eif4g2|hm:zeh1307|wu:fa14h01|wu:fb44h01|wu:fb59c06|wu:fc21b05|EIF4G2|DAP5|p97|AAG1|NAT1|P97|AA589388|DAP-5|E130105L11Rik|Nat1|Natm1 |
Gene, Accession # | Gene ID: 1982,13690,361628 |
Catalog # | ABIN634222 |
Price | |
Order / More Info | Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |
产品资料 |
|
|