| Edit |   |
|---|
| Antigenic Specificity | Esterase D (ESD) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ESD is a serine hydrolase involved in the detoxification of formaldehyde. |
|---|
| Immunogen | ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW |
|---|
| Other Names | FGH|Es10|Es-10|sid478|wu:fb58f05|zgc:111984|ARABIDOPSIS THALIANA S-FORMYLGLUTATHIONE HYDROLASE|ATSFGH|S-formylglutathione hydrolase|T32G6.5|T32G6_5 |
|---|
| Gene, Accession # | Gene ID: 2098 |
|---|
| Catalog # | ABIN632304 |
|---|
| Price | |
|---|
| Order / More Info | Esterase D (ESD) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|