| Edit |   |
|---|
| Antigenic Specificity | Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation. |
|---|
| Immunogen | ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD |
|---|
| Other Names | MGC63666|zgc:63666|ASCC2|ascc2|asc1p100|ASC1p100|p100|1700011I11Rik|2610034L15Rik|AI482016|AW046480|RGD1561422 |
|---|
| Gene, Accession # | Gene ID: 84164,75452,498402 |
|---|
| Catalog # | ABIN631946 |
|---|
| Price | |
|---|
| Order / More Info | Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|