| Edit |   |
| Antigenic Specificity | DEGS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 87%, rat 90%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human DEGS2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLA |
| Other Names | delta(4)-desaturase, sphingolipid 2, C14orf66, DES2, FADS8 |
| Gene, Accession # | Gene ID: 123099, UniProt: Q6QHC5, ENSG00000168350 |
| Catalog # | HPA046644 |
| Price | |
| Order / More Info | DEGS2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |